Tumblelog by Soup.io
Newer posts are loading.
You are at the newest post.
Click here to check if anything new just came in.

September 11 2013

Funkzellenabfrage: Allein in Nordrhein-Westfalen finden jeden Tag mehr als zehn Handy-Rasterfahndungen statt (Update)

Mobilfunkantennenanlage. Bild: Erwin Krauß. Lizenz: Creative Commons BY-SA 3.0.

Bei einer Funkzellenabfrage werden sämtliche Handy-Verbindungen innerhalb einer oder mehrerer dieser Funkzellen an die Polizei gegeben. Bild: Erwin Krauß. Lizenz: Creative Commons BY-SA 3.0.

Auch in Nordrhein-Westfalen werden jeden Tag Handy-Verbindungen von hunderttausenden Menschen an Polizeibehörden übermittelt und gerastert. Das geht aus einer Antwort der rot-grünen Landesregierung hervor. In ganz Deutschland dürften demnach jeden Tag dutzende Funkzellenabfragen stattfinden – statistisch ist jeder Einwohner betroffen.

In meinem Vortrag auf der SIGINT-Konferenz habe ich hochgerechnet, dass wahrscheinlich mindestens zehn Funkzellenabfragen pro Tag in Deutschland durchgeführt werden. Ich habe mich geirrt – es sind noch viel mehr. Das Problem ist, dass die offiziellen Statistiken zur Telekommunikationsüberwachung nicht zwischen individualisierten und massenhaften Abfragen unterscheiden.

Daher haben wir bei netzpolitik.org schon vor einem Jahr mehreren Landtags-Fraktionen ein paar detaillierte Fragen über Funkzellenabfragen geschickt, die diese an ihre Regierung stellen können. Neben der Piratenfraktion Schleswig-Holstein hat auch die Piratenfraktion in Nordrhein-Westfalen um den Innenausschuss-Sprecher Frank Herrmann unsere Fragen aufgenommen und eine kleine Anfrage gestellt. Jetzt ist die Antwort der Landesregierung Nordrhein-Westfalen eingetroffen, die wir an dieser Stelle exklusiv veröffentlichen.

Täglich zehn Funkzellenabfragen in Nordrhein-Westfalen

Und die Zahlen sind krass:

Für den Zeitraum vom 7.12.2010 bis 22.8.2013 sind 10.330 Funkzellenabfragen der Polzei Nordrhein-Westfalen erfasst.

Das sind mehr als zehn Funkzellenabfragen pro Tag – nur im Bundesland Nordrhein-Westfalen.

Zusammen mit den existierenden Zahlen aus Berlin und Schleswig-Holstein ergibt das folgende Tabelle an offiziell bestätigten Zahlen für Funkzellenabfragen in Deutschland:

Jahr   Berlin  SH    NRW 2009 302 151 2010 338 158 2011 568 228 3211 2012 ~342 256 4272 2013 2722


Während in Schleswig-Holstein also jährlich eine Funkzellenabfrage auf 12.311 Einwohner stattfindet, ist es eine auf 5.942 in Berlin und eine auf 4.109 Einwohner in Nordrhein-Westfalen. Statistisch ist damit jeder mindestens einmal pro Jahr betroffen.

Täglich 50 Funkzellenabfragen in Deutschland?

Wenn ich diese Zahlen völlig unwissenschaftlich mit den offiziellen Zahlen der Verkehrsdatenüberwachung hochrechne, komme ich auf die unglaubliche Zahl von 54 Funkzellenabfragen in Deutschland – jeden Tag. Das ist keinesfalls exakt – bestätigt aber die Aussage des Berliner Datenschutzbeauftragten, dass die massenhafte Handy-Rasterfahndung “zum alltäglichen Ermittlungsinstrument geworden, das routinemäßig und ohne hinreichende Beachtung der gesetzlichen Vorgaben eingesetzt wird.”

Keine Straftaten gegen Leib, Leben oder sexuelle Selbstbestimmung

Auch die Anlässe, zu denen zehntausende Handys gerastert werden, ähneln den Begründungen anderer Bundesländer. Nur fünf Prozent der Funkzellenabfragen (325 von 5.889) wurden wegen Tötungsdelikten oder Straftaten gegen die sexuelle Selbstbestimmung durchgeführt. Gegen 66 Fälle wegen Drogen sind sieben Fälle zu Waffen und zwei zu Kinderpornografie schon vernachlässigbar. Der weitaus größte Teil der Handyüberwachung wird jedoch wegen Eigentumsdelikten durchgeführt: Diebstahl, Bandendiebstahl, Raub und Erpressung. Sicherlich unangenehmen Straftaten, aber keine “schwersten Straftaten gegen Leib, Leben oder die sexuelle Selbstbestimmung“, mit denen die Maßnahme politisch begründet wird.

Zur jeweils abgedeckten Fläche oder der Anzahl der jeweils übermittelten Verkehrsdaten konnte SPD-Innenminister Ralf Jäger leider keine Auskunft geben, weil das nicht erfasst wird. Komisch, dass es in Schleswig-Holstein ging – der politische Wille muss nur da sein.

Keine Information der Überwachten

Bezeichnend ist auch die Antwort auf die Frage, wie viele der hunderttausenden betroffenen Personen jemals über die Überwachung ihrer Mobilfunk-Kommunikation informiert worden sind: Dazu werden keine Erhebungen geführt. Aber wie in allen anderen Bundesländern gehen auch die Behörden in NRW einfach davon aus, dass die Betroffenen “kein Interesse an einer Benachrichtigung” haben. Zudem betreibe man keine “Anschlussinhaberfeststellung”, um die Menschen hinter der Telefonnummer zu informieren. Braucht man auch nicht, man könnte ja einfach anrufen. Aber das ist politisch nicht gewollt, denn damit würde man ja Menschen über das unglaubliche Ausmaß der verdachtslosen Handy-Überwachung informieren. Dass die Datenschutzbeauftragten eine Nicht-Informierung für einen klaren Gesetzesbruch halten – egal.

Für andere wichtige Fragen war in der kleinen Anfrage leider kein Platz mehr: Erfolgt im Einzelfall eine Prüfung der Verhältnismäßigkeit? Liegt jeweils auch eine Straftat von auch im Einzelfall erheblicher Bedeutung zugrunde? Müssen Verdächtige ein Handy benutzt haben? Wie viele Funkzellenabfragen führten zu einer Verurteilung? Werden die Löschbestimmungen eingehalten? Werden Benachrichtigungs- und Löschpflichten protokolliert? Hier ist noch Raum für konkrete Nachforschungen.

Funkzellenabfrage abschaffen

Mit jeder neuen Auskunft verschlimmert sich das Gesamtbild über die massenhafte Handy-Überwachung in Deutschland noch. Ich zitiere daher mal mein eigenes Fazit über den Bericht des Berliner Datenschutzbeauftragten:

Erstaunlich, dass er nach all diesen Gesetzesverstößen der Behörden einfach neue Gesetze vorschlägt. Zumal die Praxis derzeit einfach fortgesetzt wird, als wäre nichts gewesen. Für netzpolitik.org ist die Konsequenz klar: Die Funkzellenabfrage gehört ersatzlos abgeschafft.

Update: Jetzt ist auch die Pressemitteilung der Piratenfraktion da: Millionenfache Standortabfragen in NRW – Bürger werden nicht nur von Prism & Co. ausgespäht:

Diese skandalöse Menge an Funkzellenabfragen ist kaum zu glauben. Bei jeder dieser 10.330 Abfragen wurden Mobilfunkdaten aller der in der Zelle befindlichen Handys an die Polizei übermittelt. Das können pro Abfrage und Zelle schnell weit über tausend Handys sein. So kommen schnell millionenfache Daten von unbescholtenen Bürgern zusammen, die durchsucht und ausgewertet werden.

Jeder ist hier betroffen. Wer zur falschen Zeit in der falschen Funkzelle war, gegen den wird ermittelt, ohne Grund und ohne Verdacht.

Wir wollen netzpolitik.org weiter ausbauen. Dafür brauchen wir finanzielle Unterstützung. Investiere in digitale Bürgerrechte.

flattr this!

July 29 2013

Nordrhein-Westfalen: Visualisierung von kommunalen Finanzdaten

Open Data ist ein wichtiger Schritt, hin zu einer Politik mit mehr Transparenz und Offenheit gegenüber den Bürgern. Leider sind die veröffentlichten Datensätze jedoch oftmals sehr komplex und unübersichtlich, was den einfachen Zugang zu den Daten erschwert. Zum Glück gibt es aber immer wieder findige Tüftler, die die Daten durchforsten und später visualisieren um sie einem breiteren Publikum zugänglich machen. Das aktuellste Beispiel hierfür liefert die Piratenfraktion im Landtag von Nordrhein-Westfalen, die die Finanzdaten der Kommunen aus Nordrhein-Westfalen in einer Karte aufbereitet hat.


Die interaktive Karte gestattet es dem Nutzer, sich einen Überblick über die Einnahmen und Ausgaben der Kommunen in Nordrhein-Westfalen zu verschaffen, ohne sich durch Datenberge wühlen zu müssen. Die Einstellungen erlauben es dem Nutzer die Einnahmen bzw. die Ausgaben als absolute Werte darzustellen oder aber im Verhältnis zur Einwohnerzahl oder der Fläche. Auch eine Aufschlüsselung in einzelne Posten wie Ausgaben für Tourismus, Betreuungsleistungen oder Theater sind möglich.

Robert Stein, Kommunal- und Finanzpolitischer Sprecher der Piratenfraktion NRW, betonte in der Pressemitteilung, dass die Visualisierung ein Schritt sei, die Finanzdaten zugänglicher zu machen:

Unser Ziel ist es, komplexe Datensätze einfach und verständlich darzustellen, damit alle Bürgerinnen und Bürger sie schnell und einfach erfassen können. Diese Visualisierung der kommunalen Finanzdaten ist nach der Visualisierung der Landeshaushalte der vergangenen Jahre ein weiterer Schritt, das Thema Finanzen in Kommunen und Land zugänglicher zu machen. Politiker müssen sich immer stärker auch der Erklärung von Politik widmen und dazu gehört, dass Nachvollziehbarkeit weitgehend barrierefrei hergestellt wird.

Die Visualisierung der kommunalen Finanzdaten ist nicht das erste Open Data-Projekt der Piratenfraktion aus Nordrhein-Westfalen. Bereits im September 2012 visualisierte die Fraktion den gesamten Landeshaushalt von Nordrhein-Westfalen.

Wir wollen netzpolitik.org weiter ausbauen. Dafür brauchen wir finanzielle Unterstützung. Investiere in digitale Bürgerrechte.

flattr this!

Sponsored post
Reposted bySchrammelhammelMrCoffeinmybetterworldkonikonikonikonikoniambassadorofdumbgroeschtlNaitliszpikkumyygittimmoejeschge

June 01 2013

NRW blickt durch – Initiativen für Transparenzgesetz und Open Government in Nordrhein-Westfalen

Wenn es nach der Kampagne NRW blickt durch geht, sollen Bürgerinnen und Bürger in Nordrhein-Westfalen künftig dank eines Transparenzgesetzes mehr und besseren Zugang zu Informationen haben. Nach Hamburger Vorbild soll das Informationsfreiheitsgesetz weiterentwickelt werden: Weg von einer Holschuld der Bürger hin zu einer Bringschuld des Staates. Damit Bürger, Unternehmen, zivilgesellschaftliche Organisationen und auch die Verwaltung freien und einfachen Zugang zu allen wichtigen Informationen aus Ämtern und Behörden erhalten, sollen in einem zentralen Informationsregister beispielsweise Verträge zur Daseinsvorsorge, Gutachten, Statistiken, Verwaltungsvorschriften, öffentliche Pläne und Geodaten veröffentlicht werden. Aus Sicht der Initiative erschwert das nicht nur Korruption und Steuerverschwendung – mehr Transparenz bedeutet auch mehr Demokratie, denn wer sich beteiligen will, muss sich schließlich informieren können.

Ausgenommen werden sollen laut dem Gesetzesvorschlag der Initiative zum Beispiel “Verträge mit einem Gegenstandswert von weniger als 20.000 Euro, wenn zwischen den Vertragspartnern im Laufe der vergangenen zwölf Monate Verträge über weniger als insgesamt 20.000 Euro abgeschlossen worden sind” und Betriebs- oder Geschäftsgeheimnisse, bei denen das Geheimhaltungsinteresse gegenüber des Informationsinteresses überwiegt.

Die von Mehr Demokratie NRW, Transparency International Deutschland und dem Bund der Steuerzahler NRW gestartete Initiative für ein Transparenzgesetz wird inzwischen auch vom Digitale Gesellschaft e.V., dem Chaos Computer Club und dem Whistleblower Netzwerk unterstützt.

Open Government Initiative der Regierung

Die Landesregierung Nordrhein-Westfalen entwickelt zwar zurzeit seine Open Government Strategie Open.NRW, die neben , E-Partizipation und E-Zusammenarbeit (e-collaboration) auch Transparenz bzw. Open Data fördern soll, doch die Einführung eines verpflichtenden Transparenzgesetzes, das auch im Koalitionsvertrag von Rot-Grün gefordert wird, ist dabei nicht vorgesehen – was letztendlich veröffentlicht wird, soll den Ministerien selbst überlassen bleiben. Im Rahmen dieser Strategie veranstaltete die nordrhein-westfälische Landesregierung am 17. Mai ein “Zukunftsforum Bürgerbeteiligung”, bei der Politik, Verwaltung und Zivilgesellschaft aufeinander trafen, um die ersten Eckpunkte der Strategie zu diskutieren und weiterzuentwickeln.

Damit Open Government gelingt, braucht es nicht nur politischen Willen, es muss auch ein Kulturwandel Einzug in die Verwaltung halten. Dass sie genau das verstanden haben, betonten Angehörige der Landesregierung und -verwaltung immer wieder. Doch beim lobenswerten Dialog zwischen Aktivisten und Verwaltung wurde auch klar, dass die Vorstellungen auseinander klaffen, was “mehr Transparenz” genau bedeutet. Das konnte man an einer Äußerung des Innenministers Jäger deutlich sehen:

Es kann nicht darum gehen, den Bürgern terabyteweise Daten bereit zu stellen. Nur Öffentlichkeit bedeutet noch nicht Beteiligung. Der Bürger muss die Daten auch verwerten können. Deshalb kann man, auch im Falle der Geodaten, nicht einfach alles zur Verfügung stellen.

Während für den Innenminister die reine Veröffentlichung von Daten keinen Gewinn darstellt und Transparenz und Open Data für ihn vor allem bedeutet, die Bürger besser zu informieren, forderten Aktivisten Mut, die Deutungshoheit abzugeben und die Rohfassung der Daten preiszugeben, die der Meinungsbildung zugrunde liegt: Nicht der Staat soll für die Bürger interpretieren, sondern diese sollten sich selbst ihre Meinung bilden.

Ein wesentliches Problem, das immer wieder bei den Transparenzbemühungen im Flächenland NRW zur Sprache kommt  ist,  wie die Kommunen eingebunden werden sollen, bei denen ein großer Teil der Datenschätze gehortet ist. Dank des sogenannten Konnexitätsprinzips muss das Land für alle zusätzlichen Aufgaben der Kommunen, wie das Bereitstellen von Daten, einen finanziellen Ausgleich schaffen – und beim verschuldeten NRW sind zusätzliche Ausgaben natürlich gar nicht gern gesehen. Sowohl Open.NRW als auch NRW blickt durch konzentrieren sich deswegen auf die Landesebene.

Mehr Infos, Dokumentationen des Zukunftsforums und die Möglichkeit, den Entwurf der Landesregierung und die Aufzeichnungen zu kommentieren, finden sich hier. Der Gesetzesentwurf  von NRW blickt durch soll nach Einarbeitung der Kommentare an die Landtagsfraktionen übergeben werden.
Mit der zivilgesellschaftlichen Initiative und den Bemühungen der Regierung ist der Weg zu mehr Transparenz in NRW eingeschlagen – was genau daraus wird ist noch offen. Ein bisschen mithelfen könnt ihr, indem ihr mit eurer Unterschrift die Petition für ein Transparenzgesetz mitzeichnet.


Wir wollen netzpolitik.org weiter ausbauen. Dafür brauchen wir finanzielle Unterstützung, auch um weiterhin einen Full-RSS-Feed anbieten zu können. Investiere in digitale Bürgerrechte.

flattr this!

Reposted by02mydafsoup-01 02mydafsoup-01

May 24 2013

Verbraucherschutzminister aller Bundesländer fordern einstimmig gesetzliche Verankerung der Netzneutralität

Das Prinzip der Netzneutralität soll im Telekommunikationsgesetz gesetzlich verankert werden. Das fordert auch die Konferenz der Verbraucherschutzminister der Länder. “Nur die gesetzliche Verankerung der Netzneutralität sichert Informations- und Meinungsfreiheit im Internet”, so die Minister.

Nach den Verbraucherzentralen nehmen sich auch die Verbraucherschutzministerien dem Thema Netzneutralität an. Die von Grünen geführten Verbraucherschutzministerien Baden-Württemberg und Nordrhein-Westfalen haben zusammen Vorschläge für Verbraucherschutz in der digitalen Welt eingebracht, darunter “die gesetzliche Verankerung der Netzneutralität im Telekommunikationsgesetz (TKG)”:

„Ein sachlich ungerechtfertigtes Verlangsamen, Benachteiligen oder Blockieren von Diensten im Internet muss zum Schutz von Verbraucherinnen und Verbrauchern rechtlich untersagt werden“, sagte Bonde. Ein neutrales Netz sei dadurch geprägt, dass es frei von Diskriminierung sei und Datenpakete unabhängig von ihrer Qualität, ihrer Quantität, von der verwendeten Anwendung, den genutzten Diensten, den Inhalten sowie ungeachtet von Sender und Empfänger gleichberechtigt transportiere. „Netzneutralität ist der Schlüssel für ein freies und offenes Internet“, betonte der Minister. Sie sei gleichermaßen wichtig für Innovation und Wirtschaftswachstum wie auch für uneingeschränkten Zugang zu Informationen. Darüber hinaus sichere Netzneutralität das Recht der Nutzerinnen und Nutzer auf Meinungsfreiheit.

Auf der Konferenz der Verbraucherschutzminister der Länder letzte Woche wurde dieser Vorschlag angenommen. Der Minister aus BaWü dazu:

Dass die Länder auf unseren Antrag hin den Bund einstimmig auffordern, endlich die bestehenden Möglichkeiten zu nutzen, um die Netzneutralität gesetzlich zu verankern, ist ein starkes Signal Richtung schwarz-gelbe Bundesregierung. Es muss verhindert werden, dass den Verbraucherinnen und Verbrauchern Nachteile entstehen, wenn ein Telekommunikationsunternehmen eigene Angebote bevorzugt oder Internetdienste sachlich ungerechtfertigt verlangsamt, benachteiligt oder blockiert. Nur die gesetzliche Verankerung der Netzneutralität sichert Informations- und Meinungsfreiheit im Internet.

Auch die anderen Vorschläge sind unterstützenswert:

Keine Schlechterstellung beim Kauf von eBooks & Co: Weiterverkauf digitaler Güter ermöglichen

„Aus Sicht der Verbraucherinnen und Verbraucher ist dies nicht nachvollziehbar und eine Schlechterstellung gegenüber dem erlaubten Weiterverkauf von analogen Gütern wie Büchern. Daher fordert Baden-Württemberg auf der VSMK, dass der Erwerb und die damit einhergehenden Rechte analoger und digitaler Güter gesetzlich gleichgestellt werden“, erläuterte Bonde. Dies gelte für eBooks, MP3-Musik, Filme und weitere digitale Güter.

Strengere gesetzliche Anforderungen an Scoring-Verfahren

Unter Scoring versteht man ein Berechnungsverfahren, bei dem Auskunfteien auf Grund von Erfahrungswerten die voraussichtliche Bonität von Verbraucherinnen und Verbrauchern beurteilen. Hier setzen sich Baden-Württemberg und die weiteren Länder für stärkere Auskunftsrechte von Betroffenen sowie mehr Wissenschaftlichkeit und Prognosegenauigkeit ein. „Wir fordern außerdem, dass bei einer Bonitätsbewertung die Adresse und das Wohnumfeld generell nicht berücksichtigt werden dürfen“, so Bonde.

Wir wollen netzpolitik.org weiter ausbauen. Dafür brauchen wir finanzielle Unterstützung, auch um weiterhin einen Full-RSS-Feed anbieten zu können. Investiere in digitale Bürgerrechte.

flattr this!

Reposted by02mydafsoup-01 02mydafsoup-01

May 10 2013

Homepageüberwachung: Polizei NRW hat mindestens 34 mal Webseiten-Besucher gerastert

Polizeibehörden des Landes Nordrhein-Westfalen haben seit 2001 mindestens 34 mal die Besucher ihrer Webseiten überwacht. Das berichtet der Innenminister auf eine kleine Anfrage, die wir veröffentlichen. Demnach wurde zwischen 2002 und 2009 immer mindestens eine staatliche Webseite überwacht.

Im September 2012 stellte der Dirk Schatz, Abgeordneter der Piratenpartei im Landtag NRW, eine kleine Anfrage zu “Homepageüberwachungen” in NRW, über die wir hier berichteten. Damals meldete das Innenministerium 19 Fälle, in denen die Behörden “sämtliche Internetzugriffe auf eine bestimmte Seite der Homepage … erhoben, gespeichert und ausgewertet” und bei “besonders auffälligen Zugriffen” die Anschlussinhaber hinter den zugreifenden IP-Adressen ermittelt haben. Kurz darauf wurden weitere Fälle bekannt.

Jetzt hat das Innenministerium eine aktualisierte Liste zusammengestellt, die wir an dieser Stelle veröffentlichen: Homepageüberwachung durch die Polizei des Landes Nordrhein-Westfalen (PDF).

Demnach wurden zwischen 2002 und 2010 statistisch zu jeder Zeit mehrere Webseiten des Landes überwacht. Die kürzeste Maßnahme dauerte eine Woche, die längste sechs Jahre. Anlass waren meist Tötungs- und Sexualdelikte, aber auch Brandstiftung und Raub. Im Jahr 2009 untersagten Justiz- und Innenministerium des Bundes diese Maßnahme, trotzdem führte die Polizei in Mönchengladbach noch im Jahr 2010 eine Homepageüberwachung durch. Hier die Zahlen:

Ermittlungsführende Behörde Delikt Beginn Dauer ca. PP Aachen Zweifaches Tötungsdelikt 2003 2 Wochen PP Bielefeld Tötungsdelikt 2005 12 Wochen   Tötungsdelikt 2007 11 Wochen   Tötungsdelikt 2008 6 Monate PP Bochum Serie von Sexualdelikten 2002 5 Wochen PP Bonn Serie von Sexualdelikten 2006 28 Monate   Tötungsdelikt 2007 16 Wochen   Tötungsdelikt 2009 14 Wochen PP Dortmund Tötungsdelikt 2004 7 Wochen   Tötungsdelikt 2006 31 Monate PP Düsseldorf Tötungsdelikt 2006 26 Wochen   Tötungsdelikt 2007 5 Wochen PP Duisburg Sexualdelikt 2004 3 Wochen   Brandstiftung 2006 1 Wochen   Androhung von Straftaten / Brandstiftung 2007 20 Monate PP Essen Zwei Sexualdelikte 2004 2 Wochen   Tötungsdelikt 2006 20 Wochen PP Hagen Tötungsdelikt 2005 28 Wochen   Tötungsdelikt 2006     Tötungsdelikt 2007 21 Wochen KPB Heinsberg Tatkomplex aus Tötungsdelikt und vier Sexualdelikten 2006 13 Wochen PP Köln Sprengstoffanschlag Keupstraße 2004 12 Monate   Tötungsdelikt 2005 9 Monate   Tötungsdelikt 2007 8 Monate   Tötungsdelikt 2007 18 Monate   Sexualdelikt 2007 15 Wochen PP Krefeld Tötungsdelikt / Sexualdelikt 2005 2 Wochen   Tötungsdelikt 2006 1 Wochen PP Mönchengladbach Tötungsdelikt 2010 21 Wochen PP Münster Schwerer Raub 2006 7 Wochen KPB Rheinisch-Bergischer Kreis Vier Sexualdelikte / Raub 2006 1 Woche KPB Rhein-Erft-Kreis Serie Raubüberfälle 2008 10 Wochen KPB Wesel Brandstiftung 2004 21 Wochen LKA NRW Zielfahndung nach einem Mehrfachmörder nach dessen Ausbruch aus der Haftanstalt 2003 6 Jahre

Hintergründe zur Homepageüberwachung und warum viele Juristen diese Maßnahme für illegal halten, haben wir hier ausgearbeitet.

vgwort pixel

Wir wollen netzpolitik.org weiter ausbauen. Dafür brauchen wir finanzielle Unterstützung, auch um weiterhin einen Full-RSS-Feed anbieten zu können. Investiere in digitale Bürgerrechte.

flattr this!

May 06 2013

Drosselkom: Verbraucherzentrale NRW mahnt Telekom ab

Die Verbraucherzentrale Nordrhein-Westfalen fordert die Deutsche Telekom auf, die umstrittenen DSL-Tarife mit Drosselung zurückzunehmen. Die Verbraucherschützer kritisieren eine “unangemessene Benachteiligung” und eine Verletzung der Netzneutralität. Bis zum 16. Mai soll die Telekom eine Unterlassungserklärung abgeben, sonst will die Verbraucherzentrale klagen.

Aus der Pressemitteilung:

Dass all dies zu einer nicht hinnehmbaren Benachteiligung der Verbraucher führt, liegt nach Ansicht der Verbraucherzentrale NRW auf der Hand. “Die Anbieter übertreffen sich in der Werbung für Internettarife seit jeher mit Flatrate- und Geschwindigkeitsversprechen”, kritisiert NRW-Verbraucherzentralenvorstand Klaus Müller das Verhalten des Telefonriesen nach Gutsherrenart, “wer Verbrauchern den Saft fürs Surfen dann übers Kleingedruckte derartig abdreht, lässt sie auf der Datenautobahn auf der Standspur stranden und nimmt ihnen damit die Möglichkeit zum diskriminierungsfreien Zugang zu allen Diensten.”

Dazu haben die Verbraucherschützer Fragen und Antworten zusammengestellt:

Was kritisiert die Verbraucherzentrale?

Wir kritisieren das Vorhaben der Telekom aus verschiedenen Gründen:

Der Internetanschluss gehört mittlerweile zur Lebensgrundlage. Der diskriminierungsfreie Zugang zu allen Diensten und Inhalten des Internets muss für jedermann gleichermaßen garantiert sein. Eine Drosselung auf das Schneckentempo von 384 Kilobit pro Sekunde führt dazu, dass eine Nutzung des Internets nur noch demjenigen möglich ist, der es sich leisten kann, weiteres Datenvolumen hinzuzubuchen. Ein Teil der Verbraucher wird dabei ausgegrenzt und eine digitale Zwei-Klassen-Gesellschaft befördert.

Darüber hinaus bedrohen die Pläne der Telekom das Prinzip der so genannten Netzneutralität – und das halten wir für nicht hinnehmbar. Netzneutralität bezeichnet den ungehinderten, gleichberechtigten Zugang zu allen Diensten und Inhalten im Internet: Datenpakete sollen durch die Internetanbieter neutral übertragen werden, ohne einzelne Dienste oder Inhalte zu bevorzugen oder zu benachteiligen. Das ist aber nicht der Fall, wenn eigene Dienste oder Partnerangebote bevorzugt behandelt und so Angebote von Wettbewerbern diskriminiert werden. Die Verbraucherzentralen fordert seit langem, die Netzneutralität gesetzlich fest zu schreiben. Wenn die EU-Kommission in dieser Sache nicht handelt, ist die Bundesregierung gefordert.

vgwort pixel

Wir wollen netzpolitik.org weiter ausbauen. Dafür brauchen wir finanzielle Unterstützung, auch um weiterhin einen Full-RSS-Feed anbieten zu können. Investiere in digitale Bürgerrechte.

flattr this!

May 10 2012

Netz-Sperren in Schulen: NRW zensiert Piratenpartei

In Nordrhein-Westfalen sperren manche Schulen das Wahlprogramm der Landes-Piratenpartei. Sie setzt sich für die Legalisierung von Cannabis ein, also wurde die Seite der Kategorie “illegale Drogen” zugeordnet. Die Herstellerfirma weist die Verantwortung von sich.

Kai Schmalenbach postete heute einen Screenshot, laut dem die Seite http://www.piratenpartei-nrw.de/landtagswahl-2012/wahlprogramm/ in einer Schule in Soest nicht aufrufbar ist:

Fukami bestätigte die Echtheit, Benedikt Fuest berichtete auf Welt Online.

Die eingesetzte Software ist Schulfilter Plus der Firma TIME for kids Informationstechnologien GmbH. Dort wirbt man gleich auf der Startseite: “Pornografie, Drogen und Gewalt müssen Schüler nicht mehr ertragen.”

Von netzpolitik.org damit konfrontiert, wollte TIME for kids nicht Schuld sein. Man stelle lediglich eine Software und eine Sperrliste zur Verfügung, aber “wir sperren nicht”. Verantwortlich für die Sperren sind die Kunden, also Schulen. TIME for kids betreibt eine Filterdatenbank von IBM, die das Web crawlt und Seiten anhand von Algorithmen kategorisiert, auch eine händische Eintragung oder Bearbeitung ist möglich. Dabei kommen “immer mal wieder Fehlkategorisierungen” vor, aber “unser Filter hat einen guten Ruf”.

Das Wahlprogramm der Piraten thematisiert nun mal Cannabis und das ist illegal. Kein Wunder, dass es in die Kategorie “illegale Drogen” zugeordnet wurde. Dass die Seite aber in einer Schule gesperrt wurde, sieht man auch als Fehler. Schuld sei wieder die Schule, immerhin ist die verwendete Filterliste schon einige Jahre alt und nicht mehr aktuell.

Vor zwei Jahren war durch TIME for kids Software auch netzpolitik.org an manchen Schulen gesperrt.

Diese Vorfälle zeigen beispielhaft die Probleme mit Internet-Filtern a la Zensursula und Jugendmedienschutz-Staatsvertrag. Einen Filter ohne Overblocking gibt es nicht.

Reposted bylossosFreXxXsashthesplashfoxbananasqampyschaaafinaichdawitlaberblablaueslichtareyouboredKryptoniteBlitzi

May 09 2012

Landtagswahl in NRW: Wahlprüfsteine von Wikimedia Deutschland, CDU für 2 Strikes plus

Nach der Free Software Foundation Europe hat auch Wikimedia Deutschland die Antworten auf ihre Wahlprüfsteine zur Landtagswahl in Nordrhein-Westfalen am Sonntag veröffentlicht. Dabei ging es um Bildungspolitik, Urheberrecht, Open Data, Netz-Sperren und Netzpolitik auf Landesebene. Wählerinnen in NRW sollten sich selbst die vollständigen Antworten durchlesen.

Die Parteien SPD, Grüne, FDP, Linke und Piraten haben recht umfangreich geantwortet, ebenso die Tierschutzpartei, die Partei der Vernunft und DIE PARTEI. Nur die CDU hat die 18 Fragen ganz allgemein geantwortet, so dass man die Antworten nicht “sinnvoll verwenden” konnte.

Fast alle Parteien lehnen Netz-Sperren (z.B. bei Glücksspiel, Persönlichkeitsrechten, rechtsextremistischen Inhalten) ab. Die SPD wirbt sogar damit, dass sie Zensursula verhindert hätten. Dazu passt das Motto Das Internet vergisst nicht!, wir haben das nämlich anders in Erinnerung. Nur die Tierschutzpartei will “gewisse Netzsperren, insbesondere bei rechtsextremistischen Inhalten.”

In NRW gibt es die “einzigen in Deutschland noch bestehenden Sperrverfügungen”, nämlich der Bezirksregierung Düsseldorf von 2002. Die meisten Parteien sind dagegen, nur die Tierschutzpartei hat keine Meinung. Die SPD behauptet, dass diese Sperren “durch die Rechtsprechung des Verwaltungsgerichtes Düsseldorf Ende 2011 aufgehoben” sein. Nach unserem Kenntnisstand betraf das jedoch nur die Glückspiel-Seiten, die Sperren gegen zwei Naziseiten dauern bei manchen Providern in NRW noch immer an. Die Frage, welche konkreten Schritte man dagegen unternehmen will, hat niemand wirklich beantwortet, auch die Sozen wollen nur irgendetwas “auf den Prüfstand” stellen.

Gebührenfinanzierte Rundfunk-Inhalte vom WDR sollen frei verfügbar sein. Manche Parteien setzen sich auch für die Möglichkeit einer Bearbeitung und Remixing ein und sprechen von Freien Lizenzen, ohne jedoch spezifisch zu werden. Die weltfremde Praxis der Depublikation wird übereinstimmend abgelehnt. Die Linke bringt dafür gleich eine Creative Commons Lizenz ins Spiel, die jedoch mit BY-ND oder BY-NC-ND ihrer vorherigen Antwort der Remix-Freiheit widerspricht.

Wikimedia fragte gar nicht erst, ob es ein Open Data Portal geben sollte, sondern gleich nach dessen konkreter Ausgestaltung. Daher sind auch alle großen Parteien irgendwie dafür, nur der Enthusiasmus unterscheidet sich.

Der Schultrojaner ist ja glücklicherweise bereits gestoppt, auch in NRW lehnen die PiratenParteien diese Schnüffelsoftware ab.

Die CDU versteht vom breiten Bereich der Netzpolitik anscheinend nur das Thema Urheberrecht und antwortete auf die landespolitischen Fragen mit einer bundespolitischen Position. Die Kernaussage scheinen diese beiden Sätze zu sein:

Anstelle einer kostenträchtigen Abmahnung könnten auch automatisierte und datenschutzneutrale Warnhinweise Nutzer auf ihr illegales Verhalten aufmerksam machen. Dabei muss jedoch auch klar sein, dass der verwarnte Nutzer bei wiederholter Rechtsverletzung mit einer ernstzunehmenden Reaktion zu rechnen hat.

Damit stellt man sich hinter das Kaudersche Modell von “2-Strikes”. Bei der ACTA-Anhörung im Bundestag konnte er sich noch freuen, dass auch der Petent Herbert Bredthauer eine kostenfreie Abmahnung befürwortet. Die Probleme mit dem vorgeschlagenen Modell haben wir jedoch bereits ausgeführt, allen voran eine Privatisierung der Rechtsdurchsetzung. Die datenschutzrechtlichen Probleme will man durch das nichtssagende Wort “datenschutzneutral” irgendwie kaschieren. Und das Schlimmste: Nach dem ersten oder zweiten Strike kommt “eine ernstzunehmende Reaktion”. Danke für die Bestätigung unserer Gründe zur Ablehnung des Vorhabens.

April 27 2012

FragDenStaat.de: Informationsfreiheits-Portal jetzt auch in Nordrhein-Westfalen

Auf FragDenStaat.de können jetzt auch Anfragen an die Verwaltung in Nordrhein-Westfalen gestellt werden. Mit FragDenStaat.de/NRW unterstützt das Portal nach der Bundesebene auch das erste Bundesland, weitere sollen folgen. Über 1.000 Kommunal- und Landesbehörden können auf Basis des Informationsfreiheitsgesetzes nach Auskunft gefragt werden.

Aus der Pressemitteilung:

Ab sofort können Bürgerinnen und Bürger in Nordrhein-Westfalen Anfragen an Kommunal- und Landesbehörden über eine zentrale Internetseite stellen. Die Organisationen Mehr Demokratie, Open Knowledge Foundation Deutschland und Transparency Deutschland haben heute den offiziellen Startschuss für das Internetportal FragDenStaat.de/NRW gegeben.

Das unabhängige Portal ermöglicht es Bürgerinnen und Bürgern, Anfragen nach den Informationsfreiheitsgesetzen (IFG) an Bundesbehörden zu stellen. Die Antwort der Behörde wird automatisch an die Plattform geleitet und dort zusammen mit der Anfrage des Nutzers veröffentlicht. Auch die Kommunal- und Landesbehörden von NRW sind jetzt in das Portal eingebunden. Damit ist NRW das erste Bundesland, in dem Bürgerinnen und Bürger über FragDenStaat.de/NRW Anfragen an Kommunal- und Landesbehörden stellen können.

Hier ist ein Disclaimer zu mir und FDS.

April 03 2012

RFC: Wikimedia-Wahlprüfsteine für NRW

Wikimedia Deutschland hat einen umfangreichen Katalog an Wahlprüfsteinen für die kommende Landtagswahl in Nordrhein-Westfalen zusammen gestellt. Bevor der Fragenkatalog an die einzelnen Parteien verschickt wird, bittet Wikimedia nochmal um Feedback: Wahlprüfsteinprüfen: Deine Mithilfe zur Landtagswahl in NRW.

Unser Vorschlag für NRW sind daher neun Fragekomplexe mit je einer sehr offenen und einer möglichst konkreten Frage. Wir wollen auf diese Weise sowohl den Parteien genügend Raum einräumen, weiter ausholen zu können und sie aber gleichzeitig dazu ermuntern, klar Stellung zu beziehen.

Jetzt seid ihr gefragt: Bitte schaut Euch unseren ersten Vorschlag an und gebt uns Rückmeldung. Welche Fragen müssen verständlicher formuliert werden, welche Themen fehlen noch, welche Fragen sind entbehrlich? Wer neue Fragen hinzufügen möchte, benenne bitte auch einen Streichkandidaten, da wir aus erwähnten Gründen nicht über 9×2 Fragen hinausgehen möchten.

March 14 2012

Happy Neuwahlen! Heute: NRW

Nach dem Saarland gibt es überraschend auch in Nordrhein-Westfalen in diesem Jahr Neuwahlen. Der Landtag hat sich eben einstimmig aufgelöst. Neuwahlen sollen vermutlich im Mai sein.

Infratest hatte als letztes folgende Umfrageergebnisse rausgegeben: CDU 35%, SPD 35%, Grüne 17%, FDP 2%, Linke 3%, Piraten 5%.

Von heute sind die von YouGov: CDU 33 %, SPD 33 %, Grüne 17 %, FDP 2 %, Linke 5 %, Piraten 7 %.

February 01 2012

Open Data-Projekt “Offenes Köln” gestartet

Ratsinformationssysteme (kurz RIS) sind innerhalb der deutschen Open Data-Community relativ häufig Thema. Grund dafür sind die oftmals schlecht benutzbaren Oberflächen, die weder einen guten Überblick darüber verschaffen, welche Themen in der entsprechenden Gemeinde oder Stadt grade diskutiert werden noch welche Dokumente zu welchen Vorgängen genau existieren oder gar geografische Zuordnungen zu politischen Entscheidungen .

Lange Zeit galt Frankfurt gestalten als eines der sehr ganz wenigen Projekte, die sich dieses Thema angenommen haben und wirklich funktionieren. Ein anderes mit einem technisch etwas anderen Ansatz ist API Leipzig.

Marian Steinbach hat nun mit Offenes Köln ein Projekt veröffentlicht, das für die politischen Vorgänge der Kölner Kommunalpolitik sowohl eine Kartendarstellung anbietet als auch eine API zur Verfügung für stellt. Ausserdem – und da wird es lustig wenn es nicht so traurig wäre – stellt Offenes Köln PDFs aus dem RIS zum direkten Download zur Verfügung. Denn das RIS der Stadt Köln bietet teilweise nur an, die Daten über POST-Request mit entsprechender Session herunter zu laden, was die direkte Verlinkung auf Ratsdokumente erheblich erschwert bzw. unmöglich macht. Das Projekt ist in einem noch frühen Stadium, dafür aber schon sehr gut benutzbar und hat einen ordentlichen Funktionsumfang. Ausserdem gibt es ein Blog, in dem über den Fortgang des Projektes regelmäßig berichtet wird, für Anregungen und Wünsche gibt es eine UserVoice-Seite.

Marian hat auf dieses Projekt übrigens im Nachgang zum Open Data Hackday Köln noch vor dem 1. Februar auf die Schienen gebracht, um es zur grade beendeten Einreichungsfrist des Wettbewerbs Apps4DE fertig zu stellen.

July 22 2011

GVU lässt sogar in Bielefeld Leute verhaften

Laut einer Pressemitteilung der Polizei NRW wurde in Bielelefeld der Betreiber eines geschlossenen Torrent-Trackers – für dessen Nutzung man Geld bezahlen musste – verhaftet.

Das passierte auf Initiative der GVU, die sich ja in letzter Zeit echt nicht lumpen lässt. Die GVU feierte kürzlich erst die Razzien zur Schließung von kino.to, kämpft gerade wohl gegen kinox.to und ist früher eher durch so geistreiche Aktionen wie dem Sperren von CC-lizensierten Videos aufgefallen. Gegen den Beschuldigten hatte die GVU im März Strafantrag gestellt. Ob daraufhin über 5 Monate lang Beweise gegen ihn gesammelt wurden, oder die Polizei erst jetzt Zeit gefunden hat, wird nicht berichtet.

Für den 46-jährigen Bielefelder sieht es wohl düster aus: Er hatte anscheindend hunderte gebrannter DVDs zu Hause rumliegen und die Polizei war auch in der Lage, die Tracker-Datenbank sicher zu stellen [und hey! Die reden in der PM "dem BitTorrent-Netz" und "dem unter Raubkopierern beliebten DViX-Format" - wenn die die Datenbank sicherstellen konnten, dann war das nicht schwer.]

Da der Beschuldigte für die Tracker-Nutzung Geld genommen haben soll, wird er wohl etwas kaum gegen den Vorwurf der gewerblichen Urheberrechtsverletzung vorbringen können. Interessant wird auch, ob die Polizei sich daran machen wird, die Zahlungs- und Nutzerdaten auszuwerten, die ja auch irgendwie aufgezeichnet worden sein müssen.

flattr this!

July 14 2011

GlüStV: Chefs der Staatskanzleien empfehlen Verzicht auf Netzsperren

Aus dem Haupt- und Medienausschusses des Landtags NRW gibt es erfreuliche Neuigkeiten zum Glücksspielstaatsvertrag. Konkret stand in der heutigen Ausschusssitzung neben einem Antrag der FDP-Fraktion zum Verzicht auf Netzsperren (PDF) auch ein Sachstandsbericht der Landesregierung (PDF) auf der Tagesordnung (HTML).

Spannend ist vor allem der Sachstandsbericht ”Zukunftsperspektiven des Lotteriemonopols / Glücksspielstaatsvertrag” der Landesregierung. Er fasst im Wesentlichen die Empfehlungen der CdS-Arbeitsgruppe “Glücksspielstaatvertrag” (CdS steht für “Chefs der Staatskanzleien”) für die Konferenz der Regierungschefinnen und Regierungschefs der Länder zusammen (MPK).

Und die sind – zumindest mit Blick auf die durch den derzeit noch aktuellen Entwurf des GlüStV drohenden – Netzsperren durchaus erfreulich:

Die von der MPK in Bezug genommenen Empfehlungen der CdS-Arbeitsgruppe berücksichtigen einige wesentliche Resultate der parallel zum Notifizierungsverfahren durchgeführten Anhörung, die ungeachtet dessen zur Zeit noch weiter ausgewertet wird. Zu den bereits jetzt empfohlenen Änderungen zählen die [...] Streichung der sog. Netzsperren als Mittel zur Bekämpfung illegaler Online-Angebote, [...]

D.h. die umstrittene Klausel § 9 Abs. 1 S. 3 Nr. 5 dürfte damit Geschichte sein und wird ihren Weg wohl nicht in die endgültige Entwurfsfassung des Staatsvertrags finden. Weitere Änderungen, u.a. was die Zahl der Lizenzen für Glücksspielanbieter betrifft, dürften anstehen, wenn in den nächsten Tagen die Stellungnahme der EU-Kommission vorliegt:

Die Beratungen zur Umsetzung dieser Empfehlungen und zur Erledigung der erteilten Prüf- und Arbeitsaufträge sind derzeit noch nicht abgeschlossen. Es ist davon auszugehen, dass das Resultat dieser Beratungen, wie auch eine etwaige Stellungnahme der EU-Kommission im Notifizierungsverfahren Grundlage weiterer Gespräche im Länderkreis sein wird, die voraussichtlich im September bzw. Oktober stattfinden werden.

Siehe dazu auch: “Neuregelung des Glücksspiels – 15 Bundesländer setzen auf’s falsche Pferd” bei Legal Tribune. Anmerkung: Autor Dr. Wulf Hambach vertritt mit seiner Kanzlei zahlreiche Klienten aus der Glücksspielbranche.

(Dank an Matthi Bolte für den Hinweis auf die Dokumenten-Nr. des Sachstandsberichts)

flattr this!

Reposted bykrekk krekk

May 26 2011

NRW-SPD: “Löschen statt Sperren” und Netzsperren sind kein Widerspruch!

Was sind schon Worte? “Löschen statt Sperren” beispielsweise? Leicht gesagt, offenbar auch leicht mal als Grundsatz in einem Koalitionsvertrag verankert … in der Praxis hingegen, da schaut es dann fix ganz anders aus. Zumindest für die SPD.

Natürlich, es ist es – einmal mehr – ein Einknicken mit Ansage. “Löschen statt Sperren” klingt prima, ist auf ordnungsrechtlicher Ebene aber offenbar kaum mehr als ein Lippenbekenntnis zur Befriedung des Netzpöbels. Das dürfte spätestens klar geworden sein, als Kurt Beck im Dezember angesichts des Scheiterns des JMStV-E präventiv “Regulierung von oben” inkl. “Sperrverfügungen” ankündigte.*

Auch im Kontext des derzeit in der Entwurfsphase befindlichen Glücksspiel-Staatsvertrags (GlüStV) befindet sich bekanntlich eine Passage, die “Löschen statt Sperren” zu einer potentiellen Sollbruch der rot-grünen Koalitionsverträge in Rheinland-Pfalz, Baden-Württemberg und NRW werden lässt (im rot-roten Berlin hat es diese Woche hinter den Kulissen auch schon gekracht …).

Angesichts der beiden real existierenden Sperrverfügungen, die in NRW auch ohne im aktuell gültigen GlüStV explizit verankerte Netzsperren erlassen wurde, machen die Sozialdemokraten an Rhein und Ruhr nun deutlich, wie “Löschen statt Sperren” zu verstehen sei:

Die Regierung von Ministerpräsidentin Hannelore Kraft (SPD) will sich trotz des im Koalitionsvertrag festgehaltenen Grundsatzes “Löschen statt Sperren” die Option zum Sperren von Glücksspielseiten, die im Ausland legal sind, offen halten.

Wie und warum das möglich ist, erklärt Innenminister Ralf Jäger (SPD), der zuletzt durch seine Forderungen nach Wiedereinsetzung der Vorratsdatenspeicher pardon, Einführung einer Mindestdatenspeicherung und ein unschönes Gerücht im Rahmen einer Spendenaffäre auffällig geworden ist:

Mit der geplanten Einschränkung des Fernmeldegeheimnisses und Haftung von Access-Providern und Registraren im aktuellen Entwurf der Novellierung des Glücksspielstaatsvertrags solle die bestehende Rechtslage nicht verschärft werden, sondern lediglich präzisiert. Zu dem Grundsatz “Löschen statt Sperren” sieht Jäger keinen Widerspruch. Er beziehe sich nicht auf Glücksspielanbieter, sondern auf die Bekämpfung der Kinderpornografie. Die im Ausland lizenzierten Glücksspielangebote könnten im Gegensatz zu Kinderpornografie nicht gelöscht werden.

Ach? Ähm, das ist gerade der Witz, also, von wegen Zensur und so. Ja, so einfach ist das! Die komplette Geschichte gibt es bei Heise Online.

*Auf einer Veranstaltung des Hans-Bredow-Instituts in Hamburg hieß es gestern übrigens, die Kommission für Jugendmedienschutz wolle sich in Zukunft verstärkt um “erziehungsbeeinträchtigende Inhalte” kümmern. Ich hatte ja eigentlich schon im Fall von “isharegossip” auf eine Sperrverfügung spekuliert, bisher hat sich die KJM aber wohlweislich zurückgehalten.

Nachtrag: Apropos “isharegossip”. “Der Westen”, das Nachrichtenportal der WAZ-Gruppe, meldet gerade, dass “Zielfahnder” einen der Betreiber von “isharegossip” gefasst haben. Vorwurf: “Verdacht auf Volksverhetzung”.

flattr this!

May 04 2011

GlüStV: Verwirrung um Sperrverfügungen

Es gibt eine gute und drei nicht ganz so gute Nachrichten zum Glückspiel-Staatsvertrag. Beginnen wir mit der ersten nicht so guten Nachricht.

Am Wochenende auf JMStVCamp in Essen kursierte das Gerücht, im aktuellen Entwurf des Glückspielsstaatsvertrags wäre eine erst kürzlich aufgenommene Passage gestrichen worden, die dedizierte Netzsperren auf Zugangsebene, bzw. die Enteignung von Domains ermöglicht. Das wäre dann wohl die umstrittene Nr. 5 in § 9 “Glücksspielaufsicht” gewesen (Hervorhebung von mir):

5. Diensteanbietern im Sinne des Telemediengesetzes, insbesondere Zugangsprovidern und Registraren, nach vorheriger Bekanntgabe unerlaubter Glücksspielangebote die Mitwirkung am Zugang zu den unerlaubten Glücksspielangeboten untersagen.

Auf Rückfrage bei der zuständigen Staatskanzlei Sachsen-Anhalt konnte man mir die Streichung leider nicht bestätigen. Aktuell wäre weiterhin der Entwurf vom 14.04., wie er auch der EU-Kommission zur Notifizierung vorgelegt wurde. Denkbar sei allenfalls, dass einzelne Länder derzeit noch Änderungen vorbereiten. Davon wussten die Fachreferenten aber noch nichts. Unterzeichnung durch die Ministerpräsidenten? Evtl. im August.

Entsprechende Änderungswünsche könnten beispielsweise noch aus den rot-grün regierten Bundesländer NRW, Baden-Württemberg, Rheinland-Pfalz und ggf. Bremen kommen. Mit NRW, auch das war auf dem JMStVCamp in Essen immer wieder zu hören, seien keine Netzsperren zu machen (siehe auch: Koalitionsvertrag, S.80). Auch im noch nicht abgeschlossenen rot-grünen Koalitionsvertrag in Rheinland-Pfalz soll es Passagen geben, die Netzsperren ablehnen.

Die grün-rote Koalition in BaWü hat sich unlängst in ihrem Koalitionsvertrag (PDF) ebenfalls recht deutlich gegen Netzsperren ausgesprochen, setzt sich 18 Seiten zuvor im gleichen Vertrag aber für das vom Europäischen Gerichtshof de facto längst gekippte “staatliche Monopol bei Lotterien und Sportwetten“ ein. Und zwar ohne die Widersprüche aufzulösen, wie Swen Wacker im Landesblog richtig bemerkt.

Womit wir bei den beiden anderen nicht so guten Nachrichten wären. In NRW gibt es nämlich bereits Sperrverfügungen gegen 2 Glücksspielangebote. Ja, richtig gelesen. Betroffen sind Tipp24 und BWin. Verantwortlich ist – einmal mehr – die im Zuge von Ordnung und Gefahrenabwehr für das Glückspiel im Netz zuständige Bezirksregierung Düsseldorf.

Regierungspräsident Jürgen Büssow höchstselbst hatte es sich – nach seinem ersten Anlauf 2002 – nicht nehmen lassen, als eine seiner letzten Amtshandlungen im letzten Jahr noch einmal Sperrverfügungen zu erlassen (2008 hatte es die Bezirksregierung Düsseldorf bereits mit Domain-Enteignungen versucht).

Das Gerücht hielt sich zu schon länger, Torsten Kleinz hat sich in den letzten Tagen eine offizielle Bestätigung erkämpft. Interessant ist, dass die beiden betroffenen Provider Deutsche Telekom und Vodafone die Sperren nicht umsetzen, sondern Widerspruch eingelegt haben. Der hat zwar keine aufschiebenden Wirkung, da die Bezirksregierung die Verfügungen unter neuer Leitung aber auch nicht vollstreckt, gibt es in NRW derzeit zwar Sperrverfügungen – aber keine Sperren. Alles weitere bei Heise Online und Hyperland.


flattr this!

Reposted by02mydafsoup-01 02mydafsoup-01

February 01 2011

Neues vom Internetführerschein: Zeitungsverleger erklären das Internet

Deutscher Jugend Internetpass (Symbolbild)

Deutscher Jugend Internetpass (Symbolbild)*

Erinnert sich noch jemand, wie wir uns letzten Herbst über den abgestuften “Medienkompetenzführerschein” in Nordrhein-Westfalen lustig gemacht haben? Zugegeben, das war billig. Tatsächlich sind in der Debatte, wie wir den Sprung über den digitalen Graben schaffen, bisher noch viele Fragen unbeanwortet. Und ja, die Zeit drängt durchaus.

Diskussionen zum Internetführerschein oder vergleichbare Qualifikationsnachweise drehen sich in der Regel um zwei scheinbar gegensätzliche Pole: Auf der einen Seite die – nicht nur für die digitale Gesellschaft – essenstielle Fähigkeit zu Abstraktion bei der Problemlösung. Auf der anderen Seite das vgl. stumpfe Abprüfen normierten Faktenwissens zwecks besserer Vergleichbarkeit der Prüflinge.

Nun ist das Abprüfen normierten Faktenwissens nicht pauschal schlecht. Eine gemeinsame Basis bzw. ein Regelwerk, auf das sich alle an einem Prozess Beteiligten einigen können, erleichtert Dinge wie Kommunikation und Zusammenarbeit schließlich ungemein. Spätestens aber, wenn über das normierte Faktenwissen ein ideologischer Wertekanon etabliert oder gefestigt werden soll, stellt sich die Frage der Definitionshoheit.

Genug geschwurbelt. Stefan Niggemeier hat gerade ein schönes Beispiel aus der Praxis. Es geht um eine Unterrichtseinheit zum „Medienführerschein” der Bayerische Staatskanzlei:

Unter dem Vorwand einer guten Sache, nämlich Kinder dafür zu sensibilisieren, dass nicht jeder Information zu trauen ist und dass Quellen unterschiedlich vertrauenswürdig sind, erzählt der bayerische „Medienführerschein” ihnen das Märchen von der Überlegenheit gedruckter Nachricht. Es geht nicht nur um den Kontrast professionell ersteller journalistischer Informationen zu privaten Blogs — eine zumindest theoretisch sinnvolle Gegenüberstellung [...] Die Unterrichtsmaterialen mischen das konsequent mit dem behaupteten qualitativen Unterschied zwischen Print und Online.

Herausgeber der Unterrichtseinheit ist der Verband Bayerischer Zeitungsverleger (VBZV).

*Vielen Dank für die Illustration an Karl Bihlmeier. Karl Bihlmeier? Ja, genau, der Karl Bihlmeier, Vater von Hermann, dem User!

Reposted bymondkroete mondkroete

December 16 2010

Jugendmedienschutzstaatsvertrag in NRW einstimmig abgelehnt

Keine neue News, weil wir das gestern schon gebloggt hatten, aber: Der Jugendmedienschutzstaatsvertrag ist soeben im Landtag von NRW einstimmig abgelehnt worden. Vorausgegangen war eine langwierige und etwas langweilige Debatte, wo die Wörter Netzgemeinde und Blogs ziemlich oft gefallen sind. Wir haben aber mangels ruckelfreiem Stream die jeweilige Wortnennungsanzahl nicht zählen können.

Was wir uns zukünftig wünschen: Einen besseren Livestream für den Landtag in NRW. Real Player mit 320er-Auflösung ist echt 90er-Technik und das Ergbnis versprüht dann auch eher einen 70er-Charme, wie der Screenshot zeigt (Intelligentere und spannendere Inhalte in der Plenar-Debatte wären auch noch toll).

December 14 2010

+++ Eil & Kurz +++ Vorentscheidung in NRW (jetzt wirklich!)

Schrieb ich vorhin, dass die Vorentscheidung zum JMStV in NRW heute Abend im Koalitionsausschuss der rot-grünen Minderheitsregierung fallen wird? Nun, ich befürchte, ich muss mich da korrigieren. Ich habe gerade mit dem Pressesprecher der CDU-Fraktion telefoniert und mir bestätigen lassen, was bisher nur ein Gerücht war.

Die CDU-Fraktion will am Donnerstag  gegen den Gesetzentwurf stimmen. Ich wiederhole: Die CDU-Fraktion will am Donnerstag  gegen den Gesetzentwurf stimmen.

Nein, ich kann immer noch nicht glauben, was ich gerade schreibe. Die Konsequenzen hingegen wären wohl klar: Der unsägliche Staatsvertrag könnte am Donnerstag ausgerechnet durch eine Koalition aus CDU, FDP und Linken gestoppt werden. Hell freezes over!

Und ja, ich habe dreimal nachgefragt. Und dann noch einmal, mit anderen Worten. Das Ergebnis war eindeutig: Die CDU-Fraktion will am Donnerstag  gegen den Gesetzentwurf stimmen! Eine offizielle Bestätigung wird wohl erst morgen geben. Bis dahin dürft ihr mir glauben, was ich selber noch nicht glauben kann.

PS: Lieber rot-grüner Koalitionsausschuss, ihr wisst, wer am Donnerstag nicht nur vor der “Internet-Community” ziemlich dumm darstehen würde, wenn SPD und Grüne dennoch für den Gesetzentwurf stimmen würden? Genau. Ich wollte es nur noch einmal erwähnen.

Reposted bykrekklotterleben

December 13 2010

JMStV: Die Woche der Entscheidungen

Der Worte sind genug gewechselt (Etwas Zeit für ein Webunterschrift ist freilich immer drin! Vgl. Pressemeldung.). Diese Woche entscheidet sich, ob wir uns ab dem 01.01.2011 mit den Regelungen des novellierten Jugendmedienschutz-Staatsvertrags herumschlagen müssen. Und so schaut’s aus:


14.12.: NRW, früher Nachmittag, vsl. Vorentscheidung der Fraktionen
14.12.: Sachsen, ab etwa 11:30 Uhr, Livestream
14.12.: Bayern, 16:50 Uhr, Livestream

15.12.: Mecklenburg-Vorpommern, 13:10 Uhr, Livestream
15.12.: Brandenburg, 16:25 Uhr

16.12.: Schleswig-Holstein, ab etwa 11 Uhr, Livestream
16.12.: NRW, 15:35 Uhr, Livestream

(Die Zeitangaben sind erfahrungsgemäß bestenfalls grobe Richtwerte)

Lange Version:

Am Dienstag, dem 14.12., dürfen wir irgendwann am Nachmittag mit der Vorentscheidung aus Nordrhein-Westfalen rechnen. Die (wohl entscheidenden) Fraktionssitzungen von Grünen (Beginn: 10:15 Uhr) und SPD (Beginn: 11 Uhr) sind jedenfalls für den späten Vormittag angesetzt. Die CDU-Fraktion trifft sich ab 10 Uhr.

Eigentlich wäre die (Vor-)Entscheidung ja bereits am Freitag in Form einer Beschlussempfehlung des Haupt- und Medienausschuss fällig gewesen. Die Fraktionen von SPD, Grünen und CDU haben sich aber noch etwa Zeit zur (internen) Entscheidungsfindung erbeten. Vielleicht wollten die Verantwortlichen auch etwas Druck rausnehmen und einen Shitstorm am Wochenende vermeiden. Sei’s drum.

Zeitnah dürfte auch im Sächsischen Landtag die Entscheidung fallen. Dort steht die 2. und entscheidende Lesung des 14. Rundfunkänderungsstaatsvertrag als TOP 3 auf der Tagesordung des Plenums. Eine Überraschung dürfte es in Sachsen nicht geben.

Die Mehrheitsverhältnisse im Landtag sind ebenso klar, wie die Beschlussempfehlung des “Ausschusses für Wissenschaft und Hochschule, Kultur und Medien” (PDF). Der Staatsvertrag dürfte also mit den Stimmen der Regierungskoalition aus CDU und FDP ratifiziert werden. Wer mag, kann sich das Prozedere in einem Livestream anschauen.

Die Entscheidung im Bayerischen Landtag wird man ebenfalls live im Netz verfolgen können. Und zwar ebenfalls noch am Dienstag, grob geschätzt ab 16:50 Uhr (evtl. auch etwas früher). Auf der Tagesordnung steht der JMStV als TOP5 (PDF)

Sonderlich spannend dürfte es auch in Bayern nicht werden. Von den Grünen abgesehen, haben sich in der Beschlussempfehlung des federführenden “Ausschusses für Hochschule, Forschung und Kultur” (PDF) alle im Landtag vertretenen Partei für eine Zustimmung zum Staatsvertrag ausgesprochen.

Weiter geht es am Mittwoch. Um 13:10 Uhr soll in Landtag von Mecklenburg-Vorpommern über den Staatsvertrag abgestimmt werden. Und zwar ohne weitere Beratung oder Redebeiträge (PDF). Da in MeckPom eine große Koalition regiert und der federführende Innenausschuss in seiner Beschlussempfehlung vom 8.12. (PDF) die Zustimmung zum Staatsvertrag empfohlen hat, dürfte es fix gehen. Wer trotzdem reinschauen mag: Hier soll es eine Liveübertragung geben.

Keine Liveübertragung im Netz gibt es, wenn ich das richtig sehe, aus Brandenburg. Dort wird am Mittwoch gegen 16:25 Uhr ohne weitere Debatte über den JMStV abgestimmt. Der Hauptausschuss empfiehlt die Annahme in unveränderter Form (PDF), die rot-rote Koalition dürfte der Empfehlung folgen.

Am Donnerstag schließlich folgt das große Finale. Spätestens zur Mittagszeit dürften sich die Augen und Ohren der netzpolitischen Welt (oder zumindest die derer, die tapfer meine sperrigen Blogeinträge zum JMStV verfolgen) Richtung Kiel richten. High-Noon an der Küste!

Irgendwann zwischen 11 und 12 Uhr (grob geschätzt!) wird die Entscheidung in Schleswig-Holstein fallen. Und die dürfte spannender werden, als man noch vor ein paar Tagen annehmen durfte.

Wir erinnern uns: Da letzten Mittwoch bei der entscheidenenen Abstimmung im Innen- und Rechtsausschuss ein Abgeordneter der CDU fehlte, musste das Gremium dem schleswig-holsteinischen Landtag die Ablehnung des JMStV empfehlen:

Die Ausschussmitglieder schlossen außerdem auch ihre Beratungen über den Gesetzentwurf der Landesregierung zu 14.  Rundfunkänderungsstaatsvertrag, Drucksache 17/744, ab. Mit den Stimmen von sechs Abgeordneten der Fraktionen von SPD, BÜNDNIS 90/DIE GRÜNEN, DIE LINKE und SSW gegen die Stimmen von sechs Abgeordneten der Fraktionen von CDU und FDP empfahl er dem Landtag, den Gesetzentwurf der Landesregierung, Drucksache 17/744, abzulehnen.

Gemach, Gemach! Das allein muss noch nichts heissen. Interessanter sind zwei andere Aspekte:

a) Die Mehrheit der schwarz-gelben Regierung ist mit einer Stimme recht knapp und wohl auch alles andere als stabil
d) Die SPD-Fraktion hat sich im Vorfeld gegen eine Zustimmung zum JMStV ausgesprochen

Kurz: Eine Überraschung in Kiel ist durchaus im Bereich des Möglichen.
Besser noch: Man kann live dabei sein!

    Liebe Abgeorndete der CDU im Kieler Landtag,

    wollen Sie diesen Unsinn wirklich mitmachen? Wollen Sie wirklich verantwortlich für einen inhaltlich und fachlich misslungenen Staatsvertrag sein, der Ihnen – nach Aussage aus der Mainzer Staatskanzlei – von der SPD auf Länderebene reingedrückt wurde? Von den Menschen im Norden sagt man, sie hätten einen eigenen Kopf. Es wäre schön, wenn man das am Donnerstag sehen könnte. Stimmen Sie gegen den Entwurf, der Chef wird’s überleben!

    Liebe Abgeordnete der SPD,

    ich kann mir gut vorstellen, dass derzeit die Telefone glühen. Klar, die SPD, das Erbe von Kurt Beck und überhaupt. Denken Sie bei einen Deal aber vielleicht auch kurz darüber nach, was ein erneutes Umfallen für die Glaubwürdigkeit der SPD bedeuten würden. Mal abgesehen von den Sachargumenten, die gegen den JMStV sprechen, finde ich: Sie könnten sich dann auch gleich vom Deich stürzen. Und die Büste von Willy Brandt eigentlich gleich mit. Ist es das wert? Ich denke nicht.

    Liebe Abgeordnete der Grünen, von der Linken und vom SSW,

    bei Ihnen muss ich mir keine Sorgen machen, oder? Sie wissen, was für ein Murks der Gesetzentwurf ist. Da Sie in Schleswig-Holstein auch keinen parlamentarischen Zwängen unterworfen sind, vertraue ich mal darauf, dass Sie sich richtig entscheiden werden. Prima.

Bleibt die Entscheidung in Nordrhein-Westfalen. Die soll – laut Tagesordnung -  am Donnerstag um ~15:35 Uhr  fallen (Hier live). Wobei, ich gehe davon aus, dass bereits im Vorfeld durchsickert, wie sich die Fraktionen von SPD und Grünen entscheiden werden.

Wer überrascht ist, dass der gemeinsame Entschließungsantrag von Rot-Grün auf der Tagesordnung fehlt: Der macht natürlich nur Sinn, wenn die Koalition sich auch für die Annahme des Staatsvertrags entscheidet. Bedeutet: Sollte der Entschließungsantrag im Laufe der Woche auf der Tagesordnung auftauchen, gab es eine Vorentscheidung.

Dass es mir lieber wäre, wenn SPD und Grüne über ihren Schatten springen und sich dem Antrag der FDP (PDF) anschließen, muss ich nicht betonen. Unwahrscheinliche Variante, schon aus Prinzip? Sicher. Aber, bei allem Respekt, wer einem Antrag wider besseren Gewissens nicht zustimmen mag, weil er vom politischen Gegner eingebracht wurde, sollte die Begriff “Würde” und “Parlament” ggf. aus seinem Wortschatz streichen.

Reposted bykrekk02mydafsoup-01
Older posts are this way If this message doesn't go away, click anywhere on the page to continue loading posts.
Could not load more posts
Maybe Soup is currently being updated? I'll try again automatically in a few seconds...
Just a second, loading more posts...
You've reached the end.
No Soup for you

Don't be the product, buy the product!

YES, I want to SOUP ●UP for ...